PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013609510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 324aa    MW: 36499.5 Da    PI: 9.7375
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013609510.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-1683128147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W+ Ia+++  gR++k+c++rw++ 
   XP_013609510.1  83 RGHWRPTEDAKLKELVAQFGPQNWNVIAHHLL-GRSGKSCRLRWFNQ 128
                      899****************************9.***********996 PP

2Myb_DNA-binding51.72.1e-16136178246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++T+eE+ +l+ +++ +G++ W++I+r ++ gRt++ +k++w+ 
   XP_013609510.1 136 RAFTEEEESRLLAVHQAYGNK-WALISRLFP-GRTDNAVKNHWHV 178
                      689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.67178129IPR017930Myb domain
SMARTSM007176.0E-1482131IPR001005SANT/Myb domain
SuperFamilySSF466893.37E-2883176IPR009057Homeodomain-like
PfamPF002491.2E-1583128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2484136IPR009057Homeodomain-like
CDDcd001677.31E-1386127No hitNo description
PROSITE profilePS5129424.202130184IPR017930Myb domain
SMARTSM007171.3E-13134182IPR001005SANT/Myb domain
PfamPF002497.2E-14136177IPR001005SANT/Myb domain
CDDcd001671.50E-10137177No hitNo description
Gene3DG3DSA:1.10.10.609.6E-20137183IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MNPNLLKNNL TGNYTINDSG RFEVRNNFRS PPHSHPNFSL ARKHPHNKSV SVLESGDEHE  60
KERGGNGLKR RGKNGINSKL CSRGHWRPTE DAKLKELVAQ FGPQNWNVIA HHLLGRSGKS  120
CRLRWFNQLD PRIIKRAFTE EEESRLLAVH QAYGNKWALI SRLFPGRTDN AVKNHWHVIM  180
SRRTRESQRQ RQMQTPQAPS GNADIVSSSS SYNHGELFGT VANGAVVNGE DDDGDDEDAS  240
AVSTCTTELS LTPPSSTHQA RFLNYDSTLV PGKDGQCVQR AEVNGKYSKK MDHQNHHTIR  300
VSEERKVEMQ SGFYFFDFLG VGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-31831844105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609510.10.0PREDICTED: myb protein
TrEMBLA0A0D3EEN10.0A0A0D3EEN1_BRAOL; Uncharacterized protein
STRINGBra002107.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99771836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.11e-125myb domain protein 56